PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011087198.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 293aa    MW: 33426.5 Da    PI: 4.7688
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011087198.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.39e-37101091100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+C+++C lap fpa+qpk f+nvh+lFG++n+++llk+l+++++ +am+s+ ++A +r + PvyG++  i++l+ q++ +++el+
  XP_011087198.1  10 ACAACKYQRRRCTPECLLAPFFPADQPKMFQNVHRLFGVKNIQNLLKELDPDQKAMAMKSIKFHAAMRDKYPVYGCLVEIQQLSYQIQMVEEELQ 104
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++ ++
  XP_011087198.1 105 AVLQQ 109
                     98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.3029110IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-3510106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MTLKSGTGQA CAACKYQRRR CTPECLLAPF FPADQPKMFQ NVHRLFGVKN IQNLLKELDP  60
DQKAMAMKSI KFHAAMRDKY PVYGCLVEIQ QLSYQIQMVE EELQAVLQQL AYYRQQQQQQ  120
EMSPTNDYLS ELQLGMAPPR NTALSLVHED NPPQYNGVVP TLPIAPQLSY SNSPNADHYS  180
YLDFKENNVV NSLCQQPYDS NSNDNNTNSL VMHSQQLVIP QPLPHVQQET TQDYNEMHPF  240
FDHIDDTQSY IGPKEAYESS LESSMKDSRQ LVEQMDENEL KSAAACFSLT SVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087198.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A022QA291e-128A0A022QA29_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000342884e-98(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-39LOB domain-containing protein 27